SCOPe 2.02: Domain d4f1va_: 4f1v A:

Lineage for d4f1va_ (4f1v A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Phosphate-binding protein [53860] (4 species)

7. Species Pseudomonas fluorescens [TaxId:216595] [189064] (1 PDB entry)

8. Domain d4f1va_: 4f1v A: [192414]
   complexed with pi, so4

Details for d4f1va_

PDB Entry: 4f1v, 0.88 Å

PDB Description: subatomic resolution structure of a high affinity periplasmic phosphate-binding protein (pfluding) bound with phosphate at ph 8.5

PDB Compounds: (A:) Putative alkaline phosphatase

SCOPe Domain Sequences for d4f1va_:

Sequence; same for both SEQRES and ATOM records:

>d4f1va_ c.94.1.1 (A:) Phosphate-binding protein {Pseudomonas fluorescens [TaxId: 216595]}
mdingggatlpqalyqtsgvltagfaqyigvgsgngkaaflnndytkfqagvtnknvhwa
gsdsklsatelstyasakqptwgkliqvpsvgtsvaipfnksgsaavdlsvqelcgvfsg
rintwdgisgsgrtgpivvvyrsessgttelftrflnakcnaetgnfavtttfgtsfsgg
lpagavaatgsqgvmtalaagdgritymspdfaaptlaglddatkvarvgknvatntqgv
spaaanvsaaigavpvpaaadrsnpdawvpvfgpdntagvqpyptsgypilgftnlifsq
cyadatqttqvrdfftkhygasnnndaaitanafvplptawkatvrasfltasnalsign
tnvcngigrpll

Timeline for d4f1va_:

• d4f1va_ is new in SCOPe 2.02-stable
  
• d4f1va_ appears in SCOPe 2.03
  
• d4f1va_ appears in the current release, SCOPe 2.08, called d4f1va1