![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Phosphate-binding protein [53860] (4 species) |
![]() | Species Pseudomonas fluorescens [TaxId:216595] [189064] (1 PDB entry) |
![]() | Domain d4f1va1: 4f1v A:1001-1370 [192414] Other proteins in same PDB: d4f1va2, d4f1va3 complexed with pi, so4 |
PDB Entry: 4f1v (more details), 0.88 Å
SCOPe Domain Sequences for d4f1va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f1va1 c.94.1.1 (A:1001-1370) Phosphate-binding protein {Pseudomonas fluorescens [TaxId: 216595]} dingggatlpqalyqtsgvltagfaqyigvgsgngkaaflnndytkfqagvtnknvhwag sdsklsatelstyasakqptwgkliqvpsvgtsvaipfnksgsaavdlsvqelcgvfsgr intwdgisgsgrtgpivvvyrsessgttelftrflnakcnaetgnfavtttfgtsfsggl pagavaatgsqgvmtalaagdgritymspdfaaptlaglddatkvarvgknvatntqgvs paaanvsaaigavpvpaaadrsnpdawvpvfgpdntagvqpyptsgypilgftnlifsqc yadatqttqvrdfftkhygasnnndaaitanafvplptawkatvrasfltasnalsignt nvcngigrpl
Timeline for d4f1va1: