SCOPe 2.08: Domain d4f1va1: 4f1v A:1001-1370

Lineage for d4f1va1 (4f1v A:1001-1370)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Phosphate-binding protein [53860] (4 species)

7. Species Pseudomonas fluorescens [TaxId:216595] [189064] (1 PDB entry)

8. Domain d4f1va1: 4f1v A:1001-1370 [192414]
   Other proteins in same PDB: d4f1va2, d4f1va3
   complexed with pi, so4

Details for d4f1va1

PDB Entry: 4f1v, 0.88 Å

PDB Description: subatomic resolution structure of a high affinity periplasmic phosphate-binding protein (pfluding) bound with phosphate at ph 8.5

PDB Compounds: (A:) Putative alkaline phosphatase

SCOPe Domain Sequences for d4f1va1:

Sequence; same for both SEQRES and ATOM records:

>d4f1va1 c.94.1.1 (A:1001-1370) Phosphate-binding protein {Pseudomonas fluorescens [TaxId: 216595]}
dingggatlpqalyqtsgvltagfaqyigvgsgngkaaflnndytkfqagvtnknvhwag
sdsklsatelstyasakqptwgkliqvpsvgtsvaipfnksgsaavdlsvqelcgvfsgr
intwdgisgsgrtgpivvvyrsessgttelftrflnakcnaetgnfavtttfgtsfsggl
pagavaatgsqgvmtalaagdgritymspdfaaptlaglddatkvarvgknvatntqgvs
paaanvsaaigavpvpaaadrsnpdawvpvfgpdntagvqpyptsgypilgftnlifsqc
yadatqttqvrdfftkhygasnnndaaitanafvplptawkatvrasfltasnalsignt
nvcngigrpl

Timeline for d4f1va1:

• d4f1va1 first appeared in SCOPe 2.02, called d4f1va_
  
• d4f1va1 appears in SCOPe 2.07