Lineage for d4erfe_ (4erf E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1088952Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1088953Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1088954Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 1088961Protein MDM2 [47594] (2 species)
  7. 1088965Species Human (Homo sapiens) [TaxId:9606] [47596] (25 PDB entries)
  8. 1088988Domain d4erfe_: 4erf E: [192405]
    automated match to d1t4ea_
    complexed with 0r3

Details for d4erfe_

PDB Entry: 4erf (more details), 2 Å

PDB Description: crystal structure of MDM2 (17-111) in complex with compound 29 (AM-8553)
PDB Compounds: (E:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4erfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4erfe_ a.42.1.1 (E:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv

SCOPe Domain Coordinates for d4erfe_:

Click to download the PDB-style file with coordinates for d4erfe_.
(The format of our PDB-style files is described here.)

Timeline for d4erfe_: