SCOPe 2.05: Domain d4erfc_: 4erf C:

Lineage for d4erfc_ (4erf C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries)

8. Domain d4erfc_: 4erf C: [192404]
   automated match to d1t4ea_
   complexed with 0r3

Details for d4erfc_

PDB Entry: 4erf, 2 Å

PDB Description: crystal structure of MDM2 (17-111) in complex with compound 29 (AM-8553)

PDB Compounds: (C:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4erfc_:

Sequence; same for both SEQRES and ATOM records:

>d4erfc_ a.42.1.1 (C:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Timeline for d4erfc_:

• d4erfc_ first appeared in SCOPe 2.02
  
• d4erfc_ appears in SCOPe 2.04
  
• d4erfc_ appears in SCOPe 2.06
  
• d4erfc_ appears in the current release, SCOPe 2.08