SCOPe 2.08: Domain d2tcta2: 2tct A:68-208

Lineage for d2tcta2 (2tct A:68-208)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)

7. Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)

8. Domain d2tcta2: 2tct A:68-208 [19240]
   Other proteins in same PDB: d2tcta1
   complexed with ctc, mg

Details for d2tcta2

PDB Entry: 2tct, 2.1 Å

PDB Description: the complex formed between tet repressor and tetracycline-mg2+ reveals mechanism of antibiotic resistance

PDB Compounds: (A:) tetracycline repressor

SCOPe Domain Sequences for d2tcta2:

Sequence, based on SEQRES records:

>d2tcta2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records):

>d2tcta2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaalnlppllrealqimdsddgeqaflhgleslirg
fevqltallqiv

Timeline for d2tcta2:

• d2tcta2 first appeared (with stable ids) in SCOP 1.55, called d2tct_2
  
• d2tcta2 appears in SCOPe 2.07