SCOPe 2.06: Domain d4epdb_: 4epd B:

Lineage for d4epdb_ (4epd B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (2 families)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Enterobacter aerogenes [TaxId:548] [192455] (4 PDB entries)

8. Domain d4epdb_: 4epd B: [192399]
   Other proteins in same PDB: d4epda_, d4epdc1, d4epdc2
   automated match to d1ejxb_
   complexed with ni

Details for d4epdb_

PDB Entry: 4epd, 1.7 Å

PDB Description: Initial Urease Structure for Radiation Damage Experiment at 300 K

PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d4epdb_:

Sequence; same for both SEQRES and ATOM records:

>d4epdb_ b.85.3.1 (B:) Urease, beta-subunit {Enterobacter aerogenes [TaxId: 548]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d4epdb_:

• d4epdb_ first appeared in SCOPe 2.02
  
• d4epdb_ appears in SCOPe 2.05
  
• d4epdb_ appears in SCOPe 2.07
  
• d4epdb_ appears in the current release, SCOPe 2.08