| Class b: All beta proteins [48724] (177 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) ![]() |
| Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
| Protein Urease, beta-subunit [51280] (4 species) |
| Species Enterobacter aerogenes [TaxId:548] [192455] (4 PDB entries) |
| Domain d4epbb_: 4epb B: [192398] Other proteins in same PDB: d4epba_, d4epbc1, d4epbc2 automated match to d1ejxb_ complexed with ni |
PDB Entry: 4epb (more details), 1.75 Å
SCOPe Domain Sequences for d4epbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4epbb_ b.85.3.1 (B:) Urease, beta-subunit {Enterobacter aerogenes [TaxId: 548]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
Timeline for d4epbb_: