Lineage for d4epbb_ (4epb B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560599Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 1560600Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 1560601Protein Urease, beta-subunit [51280] (4 species)
  7. 1560611Species Enterobacter aerogenes [TaxId:548] [192455] (4 PDB entries)
  8. 1560614Domain d4epbb_: 4epb B: [192398]
    Other proteins in same PDB: d4epba_, d4epbc1, d4epbc2
    automated match to d1ejxb_
    complexed with ni

Details for d4epbb_

PDB Entry: 4epb (more details), 1.75 Å

PDB Description: Final Urease Structure for Radiation Damage Experiment at 100 K
PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d4epbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4epbb_ b.85.3.1 (B:) Urease, beta-subunit {Enterobacter aerogenes [TaxId: 548]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOPe Domain Coordinates for d4epbb_:

Click to download the PDB-style file with coordinates for d4epbb_.
(The format of our PDB-style files is described here.)

Timeline for d4epbb_: