Lineage for d4elzd_ (4elz D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393878Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2393879Family b.34.6.1: CcdB [50119] (1 protein)
    automatically mapped to Pfam PF01845
  6. 2393880Protein CcdB [50120] (2 species)
    topoisomerase poison
  7. 2393902Species Vibrio fischeri [TaxId:668] [189154] (7 PDB entries)
  8. 2393912Domain d4elzd_: 4elz D: [192392]
    Other proteins in same PDB: d4elza1, d4elza2, d4elzb1, d4elzb2
    complexed with gol

Details for d4elzd_

PDB Entry: 4elz (more details), 2.2 Å

PDB Description: ccdbvfi:gyra14vfi
PDB Compounds: (D:) ccdb

SCOPe Domain Sequences for d4elzd_:

Sequence, based on SEQRES records: (download)

>d4elzd_ b.34.6.1 (D:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihid
egdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi

Sequence, based on observed residues (ATOM records): (download)

>d4elzd_ b.34.6.1 (D:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpiellkapshlcptihideg
dfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi

SCOPe Domain Coordinates for d4elzd_:

Click to download the PDB-style file with coordinates for d4elzd_.
(The format of our PDB-style files is described here.)

Timeline for d4elzd_: