Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) contains insert beta-sheet subdomain and C-terminal helix |
Family b.34.6.1: CcdB [50119] (1 protein) automatically mapped to Pfam PF01845 |
Protein CcdB [50120] (2 species) topoisomerase poison |
Species Vibrio fischeri [TaxId:668] [189154] (7 PDB entries) |
Domain d4elzd_: 4elz D: [192392] Other proteins in same PDB: d4elza1, d4elza2, d4elzb1, d4elzb2 complexed with gol |
PDB Entry: 4elz (more details), 2.2 Å
SCOPe Domain Sequences for d4elzd_:
Sequence, based on SEQRES records: (download)
>d4elzd_ b.34.6.1 (D:) CcdB {Vibrio fischeri [TaxId: 668]} sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihid egdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi
>d4elzd_ b.34.6.1 (D:) CcdB {Vibrio fischeri [TaxId: 668]} sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpiellkapshlcptihideg dfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi
Timeline for d4elzd_: