SCOPe 2.06: Domain d4elzc_: 4elz C:

Lineage for d4elzc_ (4elz C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.1: CcdB [50119] (1 protein)
   automatically mapped to Pfam PF01845

6. Protein CcdB [50120] (2 species)
   topoisomerase poison

7. Species Vibrio fischeri [TaxId:668] [189154] (7 PDB entries)

8. Domain d4elzc_: 4elz C: [192391]
   Other proteins in same PDB: d4elza1, d4elza2, d4elzb1, d4elzb2
   complexed with gol

Details for d4elzc_

PDB Entry: 4elz, 2.2 Å

PDB Description: ccdbvfi:gyra14vfi

PDB Compounds: (C:) ccdb

SCOPe Domain Sequences for d4elzc_:

Sequence; same for both SEQRES and ATOM records:

>d4elzc_ b.34.6.1 (C:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihid
egdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi

Timeline for d4elzc_:

• d4elzc_ first appeared in SCOPe 2.02
  
• d4elzc_ appears in SCOPe 2.05
  
• d4elzc_ appears in SCOPe 2.07
  
• d4elzc_ appears in the current release, SCOPe 2.08