Lineage for d1c1ka_ (1c1k A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6295Fold a.120: gene 59 helicase assembly protein [48492] (1 superfamily)
  4. 6296Superfamily a.120.1: gene 59 helicase assembly protein [48493] (1 family) (S)
  5. 6297Family a.120.1.1: gene 59 helicase assembly protein [48494] (1 protein)
  6. 6298Protein gene 59 helicase assembly protein [48495] (1 species)
  7. 6299Species Bacteriophage T4 [TaxId:10665] [48496] (1 PDB entry)
  8. 6300Domain d1c1ka_: 1c1k A: [19239]

Details for d1c1ka_

PDB Entry: 1c1k (more details), 1.45 Å

PDB Description: bacteriophage t4 gene 59 helicase assembly protein

SCOP Domain Sequences for d1c1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1ka_ a.120.1.1 (A:) gene 59 helicase assembly protein {Bacteriophage T4}
miklrmpaggeryidgksvyklylmikqhmngkydvikynwcmrvsdaayqkrrdkyffq
klsekyklkelalifisnlvanqdawigdisdadalvfyreyigrlkqikfkfeedirni
yyfskkvevsafkeifeynpkvqssyifkllqsniisfetfilldsflniidkhdeqtdn
lvwnnysiklkayrkilnidsqkaknvfietvkscky

SCOP Domain Coordinates for d1c1ka_:

Click to download the PDB-style file with coordinates for d1c1ka_.
(The format of our PDB-style files is described here.)

Timeline for d1c1ka_: