Lineage for d1c1ka_ (1c1k A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008135Fold a.120: gene 59 helicase assembly protein [48492] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2008136Superfamily a.120.1: gene 59 helicase assembly protein [48493] (1 family) (S)
  5. 2008137Family a.120.1.1: gene 59 helicase assembly protein [48494] (1 protein)
  6. 2008138Protein gene 59 helicase assembly protein [48495] (1 species)
  7. 2008139Species Bacteriophage T4 [TaxId:10665] [48496] (1 PDB entry)
  8. 2008140Domain d1c1ka_: 1c1k A: [19239]
    complexed with cl, ir

Details for d1c1ka_

PDB Entry: 1c1k (more details), 1.45 Å

PDB Description: bacteriophage t4 gene 59 helicase assembly protein
PDB Compounds: (A:) bpt4 gene 59 helicase assembly protein

SCOPe Domain Sequences for d1c1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1ka_ a.120.1.1 (A:) gene 59 helicase assembly protein {Bacteriophage T4 [TaxId: 10665]}
miklrmpaggeryidgksvyklylmikqhmngkydvikynwcmrvsdaayqkrrdkyffq
klsekyklkelalifisnlvanqdawigdisdadalvfyreyigrlkqikfkfeedirni
yyfskkvevsafkeifeynpkvqssyifkllqsniisfetfilldsflniidkhdeqtdn
lvwnnysiklkayrkilnidsqkaknvfietvkscky

SCOPe Domain Coordinates for d1c1ka_:

Click to download the PDB-style file with coordinates for d1c1ka_.
(The format of our PDB-style files is described here.)

Timeline for d1c1ka_: