| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) ![]() contains insert beta-sheet subdomain and C-terminal helix |
| Family b.34.6.1: CcdB [50119] (1 protein) automatically mapped to Pfam PF01845 |
| Protein CcdB [50120] (2 species) topoisomerase poison |
| Species Vibrio fischeri [TaxId:668] [189154] (7 PDB entries) |
| Domain d4elyc_: 4ely C: [192389] Other proteins in same PDB: d4elya_, d4elyb_ complexed with cl, so4 |
PDB Entry: 4ely (more details), 1.93 Å
SCOPe Domain Sequences for d4elyc_:
Sequence, based on SEQRES records: (download)
>d4elyc_ b.34.6.1 (C:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihid
egdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi
>d4elyc_ b.34.6.1 (C:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpiepshlcptihidegdfim
ltqqmtsvpvkilsepvnelstfrneiiaaidflitgi
Timeline for d4elyc_: