Lineage for d4ekta_ (4ekt A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117849Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 1117850Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 1117851Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
  6. 1117859Protein Thaumatin [49876] (1 species)
  7. 1117860Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (47 PDB entries)
    Uniprot P02883
  8. 1117883Domain d4ekta_: 4ekt A: [192384]
    automated match to d1rqwa_
    complexed with tla

Details for d4ekta_

PDB Entry: 4ekt (more details), 1.75 Å

PDB Description: Final Thaumatin Structure for Radiation Damage Experiment at 180 K
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d4ekta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ekta_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d4ekta_:

Click to download the PDB-style file with coordinates for d4ekta_.
(The format of our PDB-style files is described here.)

Timeline for d4ekta_: