Lineage for d1loxa1 (1lox A:113-663)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776211Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 776212Superfamily a.119.1: Lipoxigenase [48484] (2 families) (S)
  5. 776241Family a.119.1.2: Animal lipoxigenases [48489] (1 protein)
  6. 776242Protein 15-Lipoxygenase [48490] (1 species)
  7. 776243Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48491] (2 PDB entries)
  8. 776246Domain d1loxa1: 1lox A:113-663 [19238]
    Other proteins in same PDB: d1loxa2
    complexed with fe2, rs7

Details for d1loxa1

PDB Entry: 1lox (more details), 2.4 Å

PDB Description: rabbit reticulocyte 15-lipoxygenase
PDB Compounds: (A:) 15-lipoxygenase

SCOP Domain Sequences for d1loxa1:

Sequence, based on SEQRES records: (download)

>d1loxa1 a.119.1.2 (A:113-663) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tgcttvgdpqglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkk
idfeaslawglaelalknslnilapwktlddfnrifwcgrsklarrvrdswqedslfgyq
flnganpmllrrsvqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvily
cqqylaaplvmlklqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssd
fqvhelnshllrghlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdf
gifdqimstgggghvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweii
sryvqgimglyyktdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtm
ciftctgqhssihlgqldwftwvpnapctmrlpppttkdatletvmatlpnlkqsslqms
ivwqlgrdqpimvplgqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeyl
rpsivensvai

Sequence, based on observed residues (ATOM records): (download)

>d1loxa1 a.119.1.2 (A:113-663) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tgcttvgdpqglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkk
idfelknslnilapwktlddfnrifgrsklarrvrdswqedslfgyqflnganpmllrrs
vqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvilycqqylaaplvmlk
lqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssdfqvhelnshllrg
hlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdfgifdqimstgggg
hvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweiisryvqgimglyyk
tdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtmciftctgqhssih
lgqldwftwvpnapctmrlpppttkdatletvmatlpnlkqsslqmsivwqlgqpimvpl
gqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeylrpsivensvai

SCOP Domain Coordinates for d1loxa1:

Click to download the PDB-style file with coordinates for d1loxa1.
(The format of our PDB-style files is described here.)

Timeline for d1loxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1loxa2