Lineage for d1lox_1 (1lox 113-663)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6281Fold a.119: Lipoxigenase [48483] (1 superfamily)
  4. 6282Superfamily a.119.1: Lipoxigenase [48484] (2 families) (S)
  5. 6291Family a.119.1.2: Animal lipoxigenases [48489] (1 protein)
  6. 6292Protein 15-Lipoxygenase [48490] (1 species)
  7. 6293Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48491] (1 PDB entry)
  8. 6294Domain d1lox_1: 1lox 113-663 [19238]
    Other proteins in same PDB: d1lox_2

Details for d1lox_1

PDB Entry: 1lox (more details), 2.4 Å

PDB Description: rabbit reticulocyte 15-lipoxygenase

SCOP Domain Sequences for d1lox_1:

Sequence, based on SEQRES records: (download)

>d1lox_1 a.119.1.2 (113-663) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus)}
tgcttvgdpqglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkk
idfeaslawglaelalknslnilapwktlddfnrifwcgrsklarrvrdswqedslfgyq
flnganpmllrrsvqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvily
cqqylaaplvmlklqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssd
fqvhelnshllrghlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdf
gifdqimstgggghvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweii
sryvqgimglyyktdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtm
ciftctgqhssihlgqldwftwvpnapctmrlpppttkdatletvmatlpnlkqsslqms
ivwqlgrdqpimvplgqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeyl
rpsivensvai

Sequence, based on observed residues (ATOM records): (download)

>d1lox_1 a.119.1.2 (113-663) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus)}
tgcttvgdpqglfqkhreqeleerrklyqwgswkeglilnvagskltdlpvderfledkk
idfeasnslnilapwktlddfnrifgrsklarrvrdswqedslfgyqflnganpmllrrs
vqlparlvfppgmeelqaqlekelkagtlfeadfalldnikanvilycqqylaaplvmlk
lqpdgklmpmviqlhlpkigssppplflptdppmvwllakcwvrssdfqvhelnshllrg
hlmaevftvatmrclpsihpvfklivphlrytleinvrarnglvsdfgifdqimstgggg
hvqllqqagafltyrsfcppddladrgllgvessfyaqdalrlweiisryvqgimglyyk
tdeavrddlelqswcreiteiglqgaqkqgfptslqsvaqachfvtmciftctgqhssih
lgqldwftwvpnapctmrlpppttkdatletvmatlpnlkqsslqmsivwqlgqpimvpl
gqhqeeyfsgpepravlekfreelaimdkeievrnekldipyeylrpsivensvai

SCOP Domain Coordinates for d1lox_1:

Click to download the PDB-style file with coordinates for d1lox_1.
(The format of our PDB-style files is described here.)

Timeline for d1lox_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lox_2