Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) |
Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
Protein automated matches [190549] (4 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (28 PDB entries) |
Domain d4ebsa_: 4ebs A: [192369] automated match to d2r90a_ complexed with amu, gol, tla |
PDB Entry: 4ebs (more details), 2.6 Å
SCOPe Domain Sequences for d4ebsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ebsa_ d.118.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
Timeline for d4ebsa_: