Lineage for d4e4ca_ (4e4c A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346223Species Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId:8663] [48631] (2 PDB entries)
    presynaptic neurotoxic phospholipase A2
  8. 2346225Domain d4e4ca_: 4e4c A: [192365]
    automated match to d1ae7a_
    complexed with mes, so4

Details for d4e4ca_

PDB Entry: 4e4c (more details), 1.8 Å

PDB Description: Crystal structure of Notexin at 1.8 A resolution
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d4e4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4ca_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]}
nlvqfsyliqcanhgkrptwhymdygcycgaggsgtpvdeldrcckihddcydeagkkgc
fpkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrc

SCOPe Domain Coordinates for d4e4ca_:

Click to download the PDB-style file with coordinates for d4e4ca_.
(The format of our PDB-style files is described here.)

Timeline for d4e4ca_: