Class a: All alpha proteins [46456] (289 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (38 species) |
Species Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId:8663] [48631] (2 PDB entries) presynaptic neurotoxic phospholipase A2 |
Domain d4e4ca_: 4e4c A: [192365] automated match to d1ae7a_ complexed with mes, so4 |
PDB Entry: 4e4c (more details), 1.8 Å
SCOPe Domain Sequences for d4e4ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4ca_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]} nlvqfsyliqcanhgkrptwhymdygcycgaggsgtpvdeldrcckihddcydeagkkgc fpkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrc
Timeline for d4e4ca_: