Lineage for d1byt_1 (1byt 168-857)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50775Fold a.119: Lipoxigenase [48483] (1 superfamily)
  4. 50776Superfamily a.119.1: Lipoxigenase [48484] (2 families) (S)
  5. 50777Family a.119.1.1: Plant lipoxigenases [48485] (1 protein)
  6. 50778Protein Lipoxigenase, C-terminal domain [48486] (2 species)
  7. 50787Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [48488] (2 PDB entries)
  8. 50788Domain d1byt_1: 1byt 168-857 [19236]
    Other proteins in same PDB: d1byt_2

Details for d1byt_1

PDB Entry: 1byt (more details), 2.2 Å

PDB Description: lipoxygenase-3 (soybean) complex with 4-nitrocatechol

SCOP Domain Sequences for d1byt_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byt_1 a.119.1.1 (168-857) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L3}
lpsetpaplvkyreeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggn
dtfpyprrgrtgrkptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpl
lqsafdlnftprefdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpp
pkviqvsksawmtdeefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehle
pnlegltvdeaiqnkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplai
elslphpqgdqsgafsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavve
pfiiatnrhlsvvhpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsa
vvykdwvftdqalpadlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvhey
vflyyksddtlredpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasa
lhaavnfgqypygglilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidl
svieilsrhasdevylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnr
cgpvqmpytlllpsskegltfrgipnsisi

SCOP Domain Coordinates for d1byt_1:

Click to download the PDB-style file with coordinates for d1byt_1.
(The format of our PDB-style files is described here.)

Timeline for d1byt_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1byt_2