Lineage for d4e1yb1 (4e1y B:6-356)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335526Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2335527Family a.102.3.1: Alginate lyase A1-III [48231] (1 protein)
  6. 2335528Protein Alginate lyase A1-III [48232] (1 species)
  7. 2335529Species Sphingomonas sp., A1 [TaxId:28214] [48233] (8 PDB entries)
  8. 2335534Domain d4e1yb1: 4e1y B:6-356 [192356]
    Other proteins in same PDB: d4e1ya2, d4e1yb2

Details for d4e1yb1

PDB Entry: 4e1y (more details), 2.1 Å

PDB Description: Alginate lyase A1-III H192A apo form
PDB Compounds: (B:) Alginate lyase

SCOPe Domain Sequences for d4e1yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e1yb1 a.102.3.1 (B:6-356) Alginate lyase A1-III {Sphingomonas sp., A1 [TaxId: 28214]}
hpfdqavvkdptasyvdvkarrtflqsgqlddrlkaalpkeydctteatpnpqqgemvip
rrylsgnhgpvnpdyepvvtlyrdfekisatlgnlyvatgkpvyatcllnmldkwakada
llnydpksqswyqvewsaataafalstmmaepnvdtaqrervvkwlnrvarhqtsfpggd
tsccnnasywrgqeatiigviskddelfrwglgryvqamglinedgsfvhemtrheqslh
yqnyamlpltmiaetasrqgidlyaykengrdihsarkfvfaavknpdlikkyasepqdt
rafkpgrgdlnwieyqrarfgfadelgfmtvpifdprtggsgtllaykpqg

SCOPe Domain Coordinates for d4e1yb1:

Click to download the PDB-style file with coordinates for d4e1yb1.
(The format of our PDB-style files is described here.)

Timeline for d4e1yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4e1yb2