Lineage for d4e1ya_ (4e1y A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1094085Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1094341Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 1094342Family a.102.3.1: Alginate lyase A1-III [48231] (1 protein)
  6. 1094343Protein Alginate lyase A1-III [48232] (1 species)
  7. 1094344Species Sphingomonas sp., A1 [TaxId:28214] [48233] (5 PDB entries)
  8. 1094347Domain d4e1ya_: 4e1y A: [192355]

Details for d4e1ya_

PDB Entry: 4e1y (more details), 2.1 Å

PDB Description: Alginate lyase A1-III H192A apo form
PDB Compounds: (A:) Alginate lyase

SCOPe Domain Sequences for d4e1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e1ya_ a.102.3.1 (A:) Alginate lyase A1-III {Sphingomonas sp., A1 [TaxId: 28214]}
gshpfdqavvkdptasyvdvkarrtflqsgqlddrlkaalpkeydctteatpnpqqgemv
iprrylsgnhgpvnpdyepvvtlyrdfekisatlgnlyvatgkpvyatcllnmldkwaka
dallnydpksqswyqvewsaataafalstmmaepnvdtaqrervvkwlnrvarhqtsfpg
gdtsccnnasywrgqeatiigviskddelfrwglgryvqamglinedgsfvhemtrheqs
lhyqnyamlpltmiaetasrqgidlyaykengrdihsarkfvfaavknpdlikkyasepq
dtrafkpgrgdlnwieyqrarfgfadelgfmtvpifdprtggsgtllaykpqg

SCOPe Domain Coordinates for d4e1ya_:

Click to download the PDB-style file with coordinates for d4e1ya_.
(The format of our PDB-style files is described here.)

Timeline for d4e1ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4e1yb_