Lineage for d4dxva_ (4dxv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2835970Species Acinetobacter baumannii [TaxId:575584] [189578] (10 PDB entries)
  8. 2835975Domain d4dxva_: 4dxv A: [192351]
    automated match to d3puda_
    complexed with cl, gol, mg

Details for d4dxva_

PDB Entry: 4dxv (more details), 1.8 Å

PDB Description: Crystal structure of Dihydrodipicolinate synthase from Acinetobacter baumannii complexed with Mg and Cl ions at 1.80 A resolution
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d4dxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dxva_ c.1.10.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
tiqgsivaivtpmlkdggvdwksleklvewhieqgtnsivavgttgeastlsmeehtqvi
keiirvankripiiagtganstreaieltkaakdlgadaallvtpyynkptqeglyqhyk
aiaeavelplilynvpgrtgvdlsndtavrlaeipnivgikdatgdvprgkalidalngk
mavysgddetawelmllgadgnisvtaniapkamsevcavaiakdeqqaktlnnkianlh
nilfcesnpipvkwalhemglidtgirlpltplaeqyreplrnalkdagii

SCOPe Domain Coordinates for d4dxva_:

Click to download the PDB-style file with coordinates for d4dxva_.
(The format of our PDB-style files is described here.)

Timeline for d4dxva_: