Lineage for d2sblb1 (2sbl B:150-839)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50775Fold a.119: Lipoxigenase [48483] (1 superfamily)
  4. 50776Superfamily a.119.1: Lipoxigenase [48484] (2 families) (S)
  5. 50777Family a.119.1.1: Plant lipoxigenases [48485] (1 protein)
  6. 50778Protein Lipoxigenase, C-terminal domain [48486] (2 species)
  7. 50779Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [48487] (7 PDB entries)
  8. 50786Domain d2sblb1: 2sbl B:150-839 [19235]
    Other proteins in same PDB: d2sblb2

Details for d2sblb1

PDB Entry: 2sbl (more details), 2.6 Å

PDB Description: the three-dimensional structure of an arachidonic acid 15-lipoxygenase

SCOP Domain Sequences for d2sblb1:

Sequence, based on SEQRES records: (download)

>d2sblb1 a.119.1.1 (B:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1}
vpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamep
fviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssa
vyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyv
plyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasal
haavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlisls
vieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnr
lgpvqlpytllypsseegltfrgipnsisi

Sequence, based on observed residues (ATOM records): (download)

>d2sblb1 a.119.1.1 (B:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1}
vpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslpaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamepfviathr
hlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssavyknwvf
tdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyvplyyard
ddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasalhaavnfg
qypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlislsvieilst
hasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnrlgpvqlp
ytllypsseegltfrgipnsisi

SCOP Domain Coordinates for d2sblb1:

Click to download the PDB-style file with coordinates for d2sblb1.
(The format of our PDB-style files is described here.)

Timeline for d2sblb1: