SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2sblb1 (2sbl B:150-839)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008080Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2008081Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2008082Family a.119.1.1: Plant lipoxigenases [48485] (2 protein domains)
    automatically mapped to Pfam PF00305
  6. 2008083Protein Lipoxigenase, C-terminal domain [48486] (2 species)
    N-terminal domain is beta-sandwich similar to colipase-binding domain of pancreatic lipase
    contains alpha plus beta subdomain: res. 341-495; alpha-beta(5)-alpha
  7. 2008084Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [48487] (17 PDB entries)
  8. 2008101Domain d2sblb1: 2sbl B:150-839 [19235]
    Other proteins in same PDB: d2sbla2, d2sblb2
    complexed with fe

Details for d2sblb1

PDB Entry: 2sbl (more details), 2.6 Å

PDB Description: the three-dimensional structure of an arachidonic acid 15-lipoxygenase
PDB Compounds: (B:) lipoxygenase-1

SCOPe Domain Sequences for d2sblb1:

Sequence, based on SEQRES records: (download)

>d2sblb1 a.119.1.1 (B:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
vpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslphsagdlsaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamep
fviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssa
vyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyv
plyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasal
haavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlisls
vieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnr
lgpvqlpytllypsseegltfrgipnsisi

Sequence, based on observed residues (ATOM records): (download)

>d2sblb1 a.119.1.1 (B:150-839) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
vpsetpaplvsyreeelkslrgngtgerkeydriydydvyndlgnpdkseklarpvlggs
stfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlkskdaleigtkslsqivqpa
fesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpvikelyrtdgqhilkfpq
phvvqvsqsawmtdeefaremiagvnpcvirgleefppksnldpaiygdqsskitadsld
ldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatrtilflredgtlkpvaie
lslpaavsqvvlpakegvestiwllakayvivndscyhqlmshwlnthaamepfviathr
hlsvlhpiyklltphyrnnmninalarqslinangiiettflpskysvemssavyknwvf
tdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwaaiktwvqeyvplyyard
ddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevcliiiwiasalhaavnfg
qypygglimnrptasrrllpekgtpeyeeminnhekaylrtitsklptlislsvieilst
hasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrrnndpslqgnrlgpvqlp
ytllypsseegltfrgipnsisi

SCOPe Domain Coordinates for d2sblb1:

Click to download the PDB-style file with coordinates for d2sblb1.
(The format of our PDB-style files is described here.)

Timeline for d2sblb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2sblb2