SCOPe 2.02: Domain d4dq4a_: 4dq4 A:

Lineage for d4dq4a_ (4dq4 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (33 PDB entries)
   Uniprot P02754

8. Domain d4dq4a_: 4dq4 A: [192347]
   complexed with eic, eoh, gol

Details for d4dq4a_

PDB Entry: 4dq4, 2.1 Å

PDB Description: Bovine beta-lactoglobulin complex with linoleic acid

PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d4dq4a_:

Sequence, based on SEQRES records:

>d4dq4a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Sequence, based on observed residues (ATOM records):

>d4dq4a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidaenkvlvldtdykkyllfcmensaeqslacqclvr
tpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d4dq4a_:

• d4dq4a_ is new in SCOPe 2.02-stable
  
• d4dq4a_ appears in SCOPe 2.03
  
• d4dq4a_ appears in the current release, SCOPe 2.08