SCOPe 2.08: Domain d4dmyb_: 4dmy B:

Lineage for d4dmyb_ (4dmy B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d4dmyb_: 4dmy B: [192345]
   automated match to d2r6na1
   complexed with 0lc, gol, so4

Details for d4dmyb_

PDB Entry: 4dmy, 1.63 Å

PDB Description: cathepsin k inhibitor

PDB Compounds: (B:) cathepsin k

SCOPe Domain Sequences for d4dmyb_:

Sequence; same for both SEQRES and ATOM records:

>d4dmyb_ d.3.1.1 (B:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d4dmyb_:

• d4dmyb_ first appeared in SCOPe 2.02
  
• d4dmyb_ appears in SCOPe 2.07