Lineage for d4dm0a1 (4dm0 A:3-476)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124325Family c.55.3.4: Transposase inhibitor (Tn5 transposase) [53115] (1 protein)
  6. 2124326Protein Transposase inhibitor (Tn5 transposase) [53116] (1 species)
    contains additional all-alpha subdomains in both N- and C-terminal regions
  7. 2124327Species Escherichia coli [TaxId:562] [53117] (6 PDB entries)
  8. 2124329Domain d4dm0a1: 4dm0 A:3-476 [192342]
    Other proteins in same PDB: d4dm0a2
    protein/DNA complex; complexed with edo, mn

Details for d4dm0a1

PDB Entry: 4dm0 (more details), 2.5 Å

PDB Description: tn5 transposase: 20mer outside end 2 mn complex
PDB Compounds: (A:) Transposase for transposon Tn5

SCOPe Domain Sequences for d4dm0a1:

Sequence, based on SEQRES records: (download)

>d4dm0a1 c.55.3.4 (A:3-476) Transposase inhibitor (Tn5 transposase) {Escherichia coli [TaxId: 562]}
tsalhraadwaksvfssaalgdprrtarlvnvaaqlakysgksitissegskaaqegayr
firnpnvsaeairkagamqtvklaqefpellaiedttslsyrhqvaeelgklgsiqdksr
gwwvhsvllleattfrtvgllhqewwmrpddpadadekesgkwlaaaatsrlrmgsmmsn
viavcdreadihaylqdklahnerfvvrskhprkdvesglylydhlknqpelggyqisip
qkgvvdkrgkrknrparkaslslrsgritlkqgnitlnavlaeeinppkgetplkwlllt
sepveslaqalrvidiythrwrieefhkawktgagaerqrmekpdnlermvsilsfvavr
llqlresftppqalraqgllkeaehvesqsaetvltpdecqllgyldkgkrkrkekagsl
qwaymaiarlggfmdskrtgiaswgalwegwealqskldgflaakdlmaqgiki

Sequence, based on observed residues (ATOM records): (download)

>d4dm0a1 c.55.3.4 (A:3-476) Transposase inhibitor (Tn5 transposase) {Escherichia coli [TaxId: 562]}
tsalhraadwaksvfssaalgdprrtarlvnvaaqlakysgksitissegskaaqegayr
firnpnvsaeairkagamqtvklaqefpellaiedttslsyrhqvaeelgklgsiqdksr
gwwvhsvllleattfrtvgllhqewwmrpddpadadekesgkwlaaaatsrlrmgsmmsn
viavcdreadihaylqdklahnerfvvrskhprkdvesglylydhlknqpelggyqisip
qkgvvdkrgkrknrparkaslslrsgritlkqgnitlnavlaeeinppkgetplkwlllt
sepveslaqalrvidiythrwrieefhkawktgagaerqrmekpdnlermvsilsfvavr
llqlresftpvesqsaetvltpdecqllgyldkgkrkrkekagslqwaymaiarlggfmd
skrtgiaswgalwegwealqskldgflaakdlmaqgiki

SCOPe Domain Coordinates for d4dm0a1:

Click to download the PDB-style file with coordinates for d4dm0a1.
(The format of our PDB-style files is described here.)

Timeline for d4dm0a1: