Lineage for d4djqb_ (4djq B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1320915Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1320931Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (39 PDB entries)
  8. 1320994Domain d4djqb_: 4djq B: [192335]
    automated match to d2f3ka_
    complexed with m86, po4

Details for d4djqb_

PDB Entry: 4djq (more details), 1.4 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with mkp86
PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d4djqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4djqb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d4djqb_:

Click to download the PDB-style file with coordinates for d4djqb_.
(The format of our PDB-style files is described here.)

Timeline for d4djqb_: