SCOPe 2.07: Domain d4djqa_: 4djq A:

Lineage for d4djqa_ (4djq A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)

8. Domain d4djqa_: 4djq A: [192334]
   automated match to d2f3ka_
   complexed with m86, po4

Details for d4djqa_

PDB Entry: 4djq, 1.4 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with mkp86

PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d4djqa_:

Sequence; same for both SEQRES and ATOM records:

>d4djqa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d4djqa_:

• d4djqa_ first appeared in SCOPe 2.02
  
• d4djqa_ appears in SCOPe 2.06
  
• d4djqa_ appears in the current release, SCOPe 2.08