Lineage for d4djqa_ (4djq A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1130029Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1131020Protein automated matches [190433] (11 species)
    not a true protein
  7. 1131048Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (38 PDB entries)
  8. 1131060Domain d4djqa_: 4djq A: [192334]
    automated match to d2f3ka_
    complexed with m86, po4

Details for d4djqa_

PDB Entry: 4djq (more details), 1.4 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with mkp86
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d4djqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4djqa_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d4djqa_:

Click to download the PDB-style file with coordinates for d4djqa_.
(The format of our PDB-style files is described here.)

Timeline for d4djqa_: