Lineage for d1ocor_ (1oco R:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6267Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 6268Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 6269Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 6270Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)
  8. 6280Domain d1ocor_: 1oco R: [19233]
    Other proteins in same PDB: d1ocoa1, d1ocob1, d1ocob2, d1ococ1, d1ocod1, d1ocof_, d1ocog1, d1ocoh_, d1ocoi1, d1ocoj1, d1ocok1, d1ocol1, d1ocom1, d1ocon1, d1ocoo1, d1ocoo2, d1ocop1, d1ocoq1, d1ocos_, d1ocot1, d1ocou_, d1ocov1, d1ocow1, d1ocox1, d1ocoy1, d1ocoz1

Details for d1ocor_

PDB Entry: 1oco (more details), 2.8 Å

PDB Description: bovine heart cytochrome c oxidase in carbon monoxide-bound state

SCOP Domain Sequences for d1ocor_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocor_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1ocor_:

Click to download the PDB-style file with coordinates for d1ocor_.
(The format of our PDB-style files is described here.)

Timeline for d1ocor_: