Lineage for d4djda_ (4djd A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1345907Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 1345994Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)
  6. 1346017Protein automated matches [190620] (2 species)
    not a true protein
  7. 1346022Species Moorella thermoacetica [TaxId:1525] [187652] (3 PDB entries)
  8. 1346027Domain d4djda_: 4djd A: [192328]
    automated match to d2e7fa_
    complexed with b12, ca, gol, sf4

Details for d4djda_

PDB Entry: 4djd (more details), 2.38 Å

PDB Description: Crystal structure of folate-free corrinoid iron-sulfur protein (CFeSP) in complex with its methyltransferase (MeTr)
PDB Compounds: (A:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d4djda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4djda_ c.1.21.2 (A:) automated matches {Moorella thermoacetica [TaxId: 1525]}
mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
qqikmladpapktvlglsnvsqncqnrplinrtflamamacgldaaiadacdealietaa
taeillnqtvycdsfvkmfktr

SCOPe Domain Coordinates for d4djda_:

Click to download the PDB-style file with coordinates for d4djda_.
(The format of our PDB-style files is described here.)

Timeline for d4djda_: