Lineage for d4dj5x_ (4dj5 X:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1166768Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1166769Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1166770Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1166808Protein Proteinase K [52762] (1 species)
  7. 1166809Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (21 PDB entries)
    Uniprot P06873
  8. 1166821Domain d4dj5x_: 4dj5 X: [192327]
    automated match to d2prka_

Details for d4dj5x_

PDB Entry: 4dj5 (more details), 1.8 Å

PDB Description: Proteinase K by Langmuir-Blodgett Hanging Drop Method at 1.8A resolution for Unique Water Distribution
PDB Compounds: (X:) Proteinase K

SCOPe Domain Sequences for d4dj5x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj5x_ c.41.1.1 (X:) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d4dj5x_:

Click to download the PDB-style file with coordinates for d4dj5x_.
(The format of our PDB-style files is described here.)

Timeline for d4dj5x_: