Lineage for d4dj1a_ (4dj1 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779642Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 1779643Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 1779644Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 1779652Protein Thaumatin [49876] (1 species)
  7. 1779653Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (53 PDB entries)
    Uniprot P02883
  8. 1779690Domain d4dj1a_: 4dj1 A: [192326]
    automated match to d1rqwa_

Details for d4dj1a_

PDB Entry: 4dj1 (more details), 1.98 Å

PDB Description: Thaumatin I by Langmuir-Blodgett Hanging Drop Method at 1.98A resolution for Unique Water Distribution
PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d4dj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj1a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d4dj1a_:

Click to download the PDB-style file with coordinates for d4dj1a_.
(The format of our PDB-style files is described here.)

Timeline for d4dj1a_: