Lineage for d4d9rb_ (4d9r B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405098Protein Factor D [50563] (1 species)
  7. 2405099Species Human (Homo sapiens) [TaxId:9606] [50564] (24 PDB entries)
  8. 2405137Domain d4d9rb_: 4d9r B: [192317]
    Other proteins in same PDB: d4d9rd1, d4d9rd2, d4d9rl1, d4d9rl2
    automated match to d1bioa_
    complexed with cl

Details for d4d9rb_

PDB Entry: 4d9r (more details), 2.42 Å

PDB Description: inhibiting alternative pathway complement activation by targeting the exosite on factor d
PDB Compounds: (B:) complement factor d

SCOPe Domain Sequences for d4d9rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d9rb_ b.47.1.2 (B:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d4d9rb_:

Click to download the PDB-style file with coordinates for d4d9rb_.
(The format of our PDB-style files is described here.)

Timeline for d4d9rb_: