Lineage for d4avja_ (4avj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767497Protein Mannose-specific adhesin FimH, N-terminal domain [418900] (2 species)
    protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2767498Species Escherichia coli [TaxId:562] [419300] (24 PDB entries)
  8. 2767512Domain d4avja_: 4avj A: [192311]
    automated match to d1uwfa1
    complexed with j73, ni, so4

Details for d4avja_

PDB Entry: 4avj (more details), 2.1 Å

PDB Description: Structure of the FimH lectin domain in the trigonal space group, in complex with a methanol triazol ethyl phenyl alpha-D-mannoside at 2.1 A resolution
PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d4avja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4avja_ b.2.3.2 (A:) Mannose-specific adhesin FimH, N-terminal domain {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d4avja_:

Click to download the PDB-style file with coordinates for d4avja_.
(The format of our PDB-style files is described here.)

Timeline for d4avja_: