Lineage for d1oczr_ (1ocz R:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6267Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 6268Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 6269Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 6270Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)
  8. 6278Domain d1oczr_: 1ocz R: [19231]
    Other proteins in same PDB: d1ocza1, d1oczb1, d1oczb2, d1oczc1, d1oczd1, d1oczf_, d1oczg1, d1oczh_, d1oczi1, d1oczj1, d1oczk1, d1oczl1, d1oczm1, d1oczn1, d1oczo1, d1oczo2, d1oczp1, d1oczq1, d1oczs_, d1oczt1, d1oczu_, d1oczv1, d1oczw1, d1oczx1, d1oczy1, d1oczz1

Details for d1oczr_

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1oczr_:

Click to download the PDB-style file with coordinates for d1oczr_.
(The format of our PDB-style files is described here.)

Timeline for d1oczr_: