![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
![]() | Protein Mannose-specific adhesin FimH [49406] (2 species) duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
![]() | Species Escherichia coli [TaxId:562] [49407] (23 PDB entries) |
![]() | Domain d4av0b_: 4av0 B: [192302] automated match to d1uwfa1 complexed with hnv, ni, so4 |
PDB Entry: 4av0 (more details), 2.1 Å
SCOPe Domain Sequences for d4av0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4av0b_ b.2.3.2 (B:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]} facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d4av0b_: