SCOPe 2.05: Domain d1ocze_: 1ocz E:

Lineage for d1ocze_ (1ocz E:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family)
   automatically mapped to Pfam PF02284

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (26 PDB entries)

8. Domain d1ocze_: 1ocz E: [19230]
   Other proteins in same PDB: d1ocza_, d1oczb1, d1oczb2, d1oczc_, d1oczd_, d1oczf_, d1oczg_, d1oczh_, d1oczi_, d1oczj_, d1oczk_, d1oczl_, d1oczm_, d1oczn_, d1oczo1, d1oczo2, d1oczp_, d1oczq_, d1oczs_, d1oczt_, d1oczu_, d1oczv_, d1oczw_, d1oczx_, d1oczy_, d1oczz_
   complexed with azi, cu, hea, mg, na, zn

Details for d1ocze_

PDB Entry: 1ocz, 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

PDB Compounds: (E:) cytochrome c oxidase

SCOPe Domain Sequences for d1ocze_:

Sequence; same for both SEQRES and ATOM records:

>d1ocze_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d1ocze_:

• d1ocze_ first appeared (with stable ids) in SCOP 1.55
  
• d1ocze_ appears in SCOPe 2.04
  
• d1ocze_ appears in SCOPe 2.06
  
• d1ocze_ appears in the current release, SCOPe 2.08