Lineage for d4auya_ (4auy A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525399Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1525404Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1525421Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 1525422Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)
  8. 1525437Domain d4auya_: 4auy A: [192299]
    automated match to d1uwfa1
    complexed with hnw, ni, so4

Details for d4auya_

PDB Entry: 4auy (more details), 2.1 Å

PDB Description: structure of the fimh lectin domain in the trigonal space group, in complex with an hydroxyl propynyl phenyl alpha-d-mannoside at 2.1 a resolution
PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d4auya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4auya_ b.2.3.2 (A:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d4auya_:

Click to download the PDB-style file with coordinates for d4auya_.
(The format of our PDB-style files is described here.)

Timeline for d4auya_: