![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor SelB, N-terminal domain [117537] (1 species) |
![]() | Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries) Uniprot Q8J307 |
![]() | Domain d4acbd4: 4acb D:2-179 [192292] Other proteins in same PDB: d4acba1, d4acba2, d4acba3, d4acba5, d4acbb1, d4acbb2, d4acbb3, d4acbc1, d4acbc2, d4acbc3, d4acbc5, d4acbd1, d4acbd2, d4acbd3 protein/RNA complex; complexed with 5gp, dxc, gdp, gnp, mg, so4 |
PDB Entry: 4acb (more details), 3.34 Å
SCOPe Domain Sequences for d4acbd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4acbd4 c.37.1.8 (D:2-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} dfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyri tlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitks dnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii
Timeline for d4acbd4: