Lineage for d1occr_ (1occ R:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6267Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 6268Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 6269Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 6270Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)
  8. 6276Domain d1occr_: 1occ R: [19229]
    Other proteins in same PDB: d1occa1, d1occb1, d1occb2, d1occc1, d1occd1, d1occf_, d1occg1, d1occh_, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo1, d1occo2, d1occp1, d1occq1, d1occs_, d1occt1, d1occu_, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1

Details for d1occr_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (R:)

SCOP Domain Sequences for d1occr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1occr_:

Click to download the PDB-style file with coordinates for d1occr_.
(The format of our PDB-style files is described here.)

Timeline for d1occr_: