Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor SelB, N-terminal domain [117537] (1 species) |
Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries) Uniprot Q8J307 |
Domain d4acbc4: 4acb C:1-179 [192288] Other proteins in same PDB: d4acba1, d4acba2, d4acba3, d4acbb1, d4acbb2, d4acbb3, d4acbc1, d4acbc2, d4acbc3, d4acbd1, d4acbd2, d4acbd3 |
PDB Entry: 4acb (more details), 3.34 Å
SCOPe Domain Sequences for d4acbc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4acbc4 c.37.1.8 (C:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii
Timeline for d4acbc4: