SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4acbc3 (4acb C:272-387)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054994Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054995Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2054996Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 protein domains)
  6. 2055010Protein Elongation factor SelB, domain 3 [117223] (1 species)
  7. 2055011Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries)
    Uniprot Q8J307
  8. 2055022Domain d4acbc3: 4acb C:272-387 [192287]
    Other proteins in same PDB: d4acba1, d4acba2, d4acba4, d4acba5, d4acbb1, d4acbb2, d4acbb4, d4acbc1, d4acbc2, d4acbc4, d4acbc5, d4acbd1, d4acbd2, d4acbd4
    protein/RNA complex; complexed with 5gp, dxc, gdp, gnp, mg, so4

Details for d4acbc3

PDB Entry: 4acb (more details), 3.34 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
PDB Compounds: (C:) translation elongation factor selb

SCOPe Domain Sequences for d4acbc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acbc3 b.44.1.1 (C:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis [TaxId: 39152]}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne
visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni

SCOPe Domain Coordinates for d4acbc3:

Click to download the PDB-style file with coordinates for d4acbc3.
(The format of our PDB-style files is described here.)

Timeline for d4acbc3: