Lineage for d4acba1 (4acb A:180-271)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793043Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species)
    EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2
  7. 2793044Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries)
    Uniprot Q8J307
  8. 2793061Domain d4acba1: 4acb A:180-271 [192277]
    Other proteins in same PDB: d4acba3, d4acba4, d4acba5, d4acbb3, d4acbb4, d4acbc3, d4acbc4, d4acbc5, d4acbd3, d4acbd4
    protein/RNA complex; complexed with 5gp, dxc, gdp, gnp, mg, so4

Details for d4acba1

PDB Entry: 4acb (more details), 3.34 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with the gtp analogue gppnhp
PDB Compounds: (A:) translation elongation factor selb

SCOPe Domain Sequences for d4acba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acba1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOPe Domain Coordinates for d4acba1:

Click to download the PDB-style file with coordinates for d4acba1.
(The format of our PDB-style files is described here.)

Timeline for d4acba1: