Lineage for d1ocrr_ (1ocr R:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 285243Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 285244Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 285245Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 285246Species Cow (Bos taurus) [TaxId:9913] [48482] (5 PDB entries)
  8. 285248Domain d1ocrr_: 1ocr R: [19227]
    Other proteins in same PDB: d1ocra_, d1ocrb1, d1ocrb2, d1ocrc_, d1ocrd_, d1ocrf_, d1ocrg_, d1ocrh_, d1ocri_, d1ocrj_, d1ocrk_, d1ocrl_, d1ocrm_, d1ocrn_, d1ocro1, d1ocro2, d1ocrp_, d1ocrq_, d1ocrs_, d1ocrt_, d1ocru_, d1ocrv_, d1ocrw_, d1ocrx_, d1ocry_, d1ocrz_
    complexed with cu, hea, mg, na, zn

Details for d1ocrr_

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocrr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus)}
shgshetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlnd
fasavrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d1ocrr_:

Click to download the PDB-style file with coordinates for d1ocrr_.
(The format of our PDB-style files is described here.)

Timeline for d1ocrr_: