Lineage for d4acab1 (4aca B:180-271)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062710Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species)
    EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2
  7. 2062711Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries)
    Uniprot Q8J307
  8. 2062722Domain d4acab1: 4aca B:180-271 [192265]
    Other proteins in same PDB: d4acaa3, d4acaa4, d4acaa5, d4acab3, d4acab4, d4acac3, d4acac4, d4acac5, d4acad3, d4acad4
    complexed with 5gp, dxc, so4

Details for d4acab1

PDB Entry: 4aca (more details), 3.15 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
PDB Compounds: (B:) translation elongation factor selb

SCOPe Domain Sequences for d4acab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acab1 b.43.3.1 (B:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOPe Domain Coordinates for d4acab1:

Click to download the PDB-style file with coordinates for d4acab1.
(The format of our PDB-style files is described here.)

Timeline for d4acab1: