Lineage for d4acaa4 (4aca A:1-179)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846274Protein Elongation factor SelB, N-terminal domain [117537] (1 species)
  7. 1846275Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries)
    Uniprot Q8J307
  8. 1846280Domain d4acaa4: 4aca A:1-179 [192264]
    Other proteins in same PDB: d4acaa1, d4acaa2, d4acaa3, d4acab1, d4acab2, d4acab3, d4acac1, d4acac2, d4acac3, d4acad1, d4acad2, d4acad3
    complexed with 5gp, dxc, so4

Details for d4acaa4

PDB Entry: 4aca (more details), 3.15 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
PDB Compounds: (A:) translation elongation factor selb

SCOPe Domain Sequences for d4acaa4:

Sequence, based on SEQRES records: (download)

>d4acaa4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr
itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk
sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

Sequence, based on observed residues (ATOM records): (download)

>d4acaa4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteigfsafklenyritlvdapghadliravvsaad
iidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemimksilq
sthnlknssiipisaktgfgvdelknliittlnnaeii

SCOPe Domain Coordinates for d4acaa4:

Click to download the PDB-style file with coordinates for d4acaa4.
(The format of our PDB-style files is described here.)

Timeline for d4acaa4: