Lineage for d4acaa1 (4aca A:180-271)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1791736Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1791794Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species)
    EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2
  7. 1791795Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries)
    Uniprot Q8J307
  8. 1791804Domain d4acaa1: 4aca A:180-271 [192261]
    Other proteins in same PDB: d4acaa3, d4acaa4, d4acab3, d4acab4, d4acac3, d4acac4, d4acad3, d4acad4
    complexed with 5gp, dxc, so4

Details for d4acaa1

PDB Entry: 4aca (more details), 3.15 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
PDB Compounds: (A:) translation elongation factor selb

SCOPe Domain Sequences for d4acaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acaa1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOPe Domain Coordinates for d4acaa1:

Click to download the PDB-style file with coordinates for d4acaa1.
(The format of our PDB-style files is described here.)

Timeline for d4acaa1: