Lineage for d4ac9d4 (4ac9 D:2-179)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867134Protein Elongation factor SelB, N-terminal domain [117537] (1 species)
  7. 2867135Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries)
    Uniprot Q8J307
  8. 2867139Domain d4ac9d4: 4ac9 D:2-179 [192260]
    Other proteins in same PDB: d4ac9a1, d4ac9a2, d4ac9a3, d4ac9a5, d4ac9b1, d4ac9b2, d4ac9b3, d4ac9c1, d4ac9c2, d4ac9c3, d4ac9c5, d4ac9d1, d4ac9d2, d4ac9d3
    protein/RNA complex; complexed with 5gp, dxc, gdp, mg, so4

Details for d4ac9d4

PDB Entry: 4ac9 (more details), 3.03 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis in complex with gdp
PDB Compounds: (D:) mj0495-like protein

SCOPe Domain Sequences for d4ac9d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ac9d4 c.37.1.8 (D:2-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
dfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyri
tlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitks
dnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

SCOPe Domain Coordinates for d4ac9d4:

Click to download the PDB-style file with coordinates for d4ac9d4.
(The format of our PDB-style files is described here.)

Timeline for d4ac9d4: