| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Elongation factor SelB, N-terminal domain [117537] (1 species) |
| Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries) Uniprot Q8J307 |
| Domain d4ac9d4: 4ac9 D:2-179 [192260] Other proteins in same PDB: d4ac9a1, d4ac9a2, d4ac9a3, d4ac9a5, d4ac9b1, d4ac9b2, d4ac9b3, d4ac9c1, d4ac9c2, d4ac9c3, d4ac9c5, d4ac9d1, d4ac9d2, d4ac9d3 protein/RNA complex; complexed with 5gp, dxc, gdp, mg, so4 |
PDB Entry: 4ac9 (more details), 3.03 Å
SCOPe Domain Sequences for d4ac9d4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ac9d4 c.37.1.8 (D:2-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
dfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyri
tlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitks
dnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii
Timeline for d4ac9d4: